PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10041088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 228aa    MW: 26164.1 Da    PI: 6.1757
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10041088genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding414.4e-13112156347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+ E++l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
      Lus10041088 112 PWTEAEHKLFLIGLSKYGKGDWRSISRNIVVSRTPTQVASHAQKY 156
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.3E-5657IPR001005SANT/Myb domain
SuperFamilySSF466891.45E-11863IPR009057Homeodomain-like
CDDcd001677.93E-41055No hitNo description
PROSITE profilePS500905.1221055IPR017877Myb-like domain
PROSITE profilePS5129420.466105161IPR017930Myb domain
SuperFamilySSF466891.35E-15106160IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-17108160IPR006447Myb domain, plants
SMARTSM007177.6E-10109159IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-10109156IPR009057Homeodomain-like
CDDcd001672.12E-8112157No hitNo description
PfamPF002497.4E-11112156IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 228 aa     Download sequence    Send to blast
MYQEPYSDHW TRSDDKKFEQ ALVFFPEDSP DRWLNIAHHM RRPVAQVLEH YDLLLRDVYE  60
IDSGQVELPT YLDDDVDNWK SSVAVEEEDS GQISFAGGKT KHGETERKKG TPWTEAEHKL  120
FLIGLSKYGK GDWRSISRNI VVSRTPTQVA SHAQKYFLRQ ISVKKERKRS SIHDITNVDM  180
NAVSPCSLQG QNQMQQQEIS TLASSYLPDH HQQEGYLMGF NSSGFPM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013653806.18e-82PREDICTED: transcription factor DIVARICATA-like
TrEMBLA0A078CY089e-82A0A078CY08_BRANA; BnaC03g01730D protein
STRINGPOPTR_0010s24710.13e-80(Populus trichocarpa)
STRINGscaffold_600421.12e-80(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF60683251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.11e-78MYB family protein